PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_38484
Common NameKK1_036395
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 322aa    MW: 36872.1 Da    PI: 4.3669
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_38484genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.71.8e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ +   G  +W+++++  g+ R++k+c++rw +yl
    C.cajan_38484 14 KGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding51.22.9e-1671111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++ E++  +d+++qlG++ W++Ia++++ gRt++++k++w+++
    C.cajan_38484  71 SEYEEKMVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                      6779**************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-20563IPR009057Homeodomain-like
PROSITE profilePS5129413.636961IPR017930Myb domain
SuperFamilySSF466896.36E-2711108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002492.0E-141461IPR001005SANT/Myb domain
CDDcd001677.98E-91661No hitNo description
PROSITE profilePS5129425.60962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2464117IPR009057Homeodomain-like
SMARTSM007173.8E-1466114IPR001005SANT/Myb domain
PfamPF002494.8E-1471111IPR001005SANT/Myb domain
CDDcd001679.47E-1174112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDKKLINFIL TNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEYEEKMVID LHAQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLKKMG  120
IDPVTHKPLP NAIEQTQNQP NQQQPEEEQQ QHQPPLQVDF DPNKEPEKAE ISLESSNITE  180
GKDEDQVIIT SPFDSMELMN GFCTDEVPII EPDEILMPCA TSSSSTSTSS SNSTNFLQDL  240
QLPDFEWSCS YNDNIIINND KNENEINNNS NMALWDDDFI SSLNWLINED DDSDGNQVFD  300
DDPFTQFSRM PMDSESWAYG LF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0958310.0BT095831.1 Soybean clone JCVI-FLGm-19P8 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007141914.11e-167hypothetical protein PHAVU_008G236500g
TrEMBLA0A151RI340.0A0A151RI34_CAJCA; Protein ODORANT1
STRINGGLYMA14G39530.11e-165(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.12e-94myb domain protein 20